Litshop 2011-12-01

Sublancin is not a lantibiotic but an S-linked glycopeptide

Trent J. Oman, John M. Boettcher, Huan Wang. Xeania N. Okalibe, and Wilfred A. van der Donk, Nature Chemical Biology, VOL7, February 2011

Sublancin Structure Proposed in Literature

Old sublancin structure

Sublancin Gene Cluster

Sublancin gene cluster

SunI is immunity protein

SunA is prepropeptide

MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR

SunT is ABC transporter

BdbA/BdbB are thiol-disulfide oxidoreductases

SunS is glycotransferase

New Proposed Structure

new sublancin structure

ESI-Q/TOF MS

ESI-Q/TOF MS plots

Fragmentation, Reducing Conditions

fragmentation in reducing conditions

Fragmentation, Non-Reducing Conditions

fragmentation in non-reducing conditions

Identifying the Sugar Moiety

GC/MS of sublancin and glucose

SunS Recognizes Multiple Sugars

SunS activity for different substrates

Bioassay Testing Different Sugars

bioassay with different substrates

Alignments with Similar Prepeptides

alignments with similar prepeptides

Similar Gene Clusters

similar gene clusters

Only the Final Peptide Shows Activity

bioassay with different sublancin precursors

Factor Xa: Alternative protease to cleave off leader peptide

/

#